PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG012470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WRKY
Protein Properties Length: 178aa    MW: 20472.8 Da    PI: 9.7873
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG012470.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.6e-32100157259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  d gy+WrKYGqK+vk+s+fprsYYrCts+gC+vkk+v+r+++d+++v++tYeg Hnh+
  CCG012470.1 100 DHGYRWRKYGQKTVKSSKFPRSYYRCTSTGCNVKKQVQRNSKDEEIVVTTYEGMHNHP 157
                  679******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-3284157IPR003657WRKY domain
SuperFamilySSF1182907.06E-2891158IPR003657WRKY domain
PROSITE profilePS5081130.76794159IPR003657WRKY domain
SMARTSM007744.4E-3599158IPR003657WRKY domain
PfamPF031068.3E-26101157IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MPMEKYQIFL PVSGPSSPSV SPSSLNMANP LTYFHGDSEN GVKPESRFQH LDAKSSVSQT  60
SRICNGSEFK VKPGKRGGDS DDFRKHRYAF QTRSQVDILD HGYRWRKYGQ KTVKSSKFPR  120
SYYRCTSTGC NVKKQVQRNS KDEEIVVTTY EGMHNHPTER SSENFEDILR QIQTYTPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2789156774Probable WRKY transcription factor 4
2lex_A2e-2789156774Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1796130.0EF179613.1 (Populus tomentosa x P. bolleana) x P. tomentosa putative WRKY transcription factor 01 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023966.11e-132PREDICTED: probable WRKY transcription factor 43
SwissprotQ9FYA21e-48WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9IFE41e-129B9IFE4_POPTR; Uncharacterized protein
STRINGPOPTR_0015s11130.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-49WRKY DNA-binding protein 75